Antibodies

Jump to Filters
View as table Download
USP9X Rabbit Polyclonal Antibody
TA309927

USD 424.00

5 Days

Rabbit Polyclonal USP9x Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Genomic peptide made to an internal region of the human Usp9X protein (within residues 1150-1300). [Swiss-Prot Q93008]
USP9X Rabbit Polyclonal Antibody
TA342579

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP9X Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-USP9X antibody: synthetic peptide directed towards the C terminal of human USP9X. Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
USP9X (2479-2492) Goat Polyclonal Antibody
AP22990PU-N

USD 440.00

2 Weeks

USP9X (2479-2492) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey
Immunogen USP9X antibody was raised against synthetic peptide from the C-terminus (near) of human USP9X (NP_001034679.2).
USP9X Rabbit Polyclonal Antibody
TA351905

USD 345.00

In Stock

Rabbit Polyclonal Anti-USP9X Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human USP9X
USP9X Rabbit Polyclonal Antibody
TA367357

USD 380.00

4 Weeks

USP9X rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human USP9X