Germany
Japan
United Kingdom
China
USP9X Rabbit Polyclonal Antibody
Product Images
Other products for "USP9X"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human, Mouse, Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-USP9X antibody: synthetic peptide directed towards the C terminal of human USP9X. Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 292 kDa |
| Gene Name | ubiquitin specific peptidase 9, X-linked |
| Database Link | |
| Background | This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Synonyms | DFFRX; FAF; FAM; MRX99; MRXS99F |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Mouse: 93% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.