Antibodies

Jump to Filters
View as table Download
GLB1 Rabbit Polyclonal Antibody
TA308238

USD 415.00

In Stock

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)
GLB1 Rabbit Polyclonal Antibody
TA332449

USD 275.00

3 Weeks

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1
HEXB Rabbit Polyclonal Antibody
TA314004

USD 345.00

4 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.
HEXA Rabbit Polyclonal Antibody
TA343107

USD 375.00

5 Days

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1E10]
CF505442

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF505544

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF505568

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1E10]
TA505442

USD 379.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1E10]
TA505442S

USD 159.00

2 Days

GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA505544

USD 379.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA505544S

USD 159.00

2 Days

GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA505568

USD 379.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
GLB1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA505568S

USD 159.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".