Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 24 of 24 results

(reset)

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

TA327031

USD 380.00

3 Weeks

CCND1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human CCND1

1 / 2

2 / 2

Previous Next

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

TA321925

USD 345.00

In Stock

Anti-CCND1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA326222

USD 345.00

In Stock

Rabbit polyclonal MYC antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 424.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA325703

USD 345.00

4 Weeks

Rabbit Polyclonal C-myc antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human C-myc

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA302042

USD 450.00

5 Days

Rabbit Polyclonal Antibody against MYC (T58)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

1 / 2

2 / 2

Previous Next

CTBP2 Rabbit Polyclonal Antibody

TA339752

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CTBP2 Rabbit Polyclonal Antibody

TA339753

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF500002

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

CF500003

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

CF500004

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CTBP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

CF807909

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

TA321926

USD 345.00

In Stock

Anti-CCND1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

CTBP2 Rabbit Polyclonal Antibody

TA323302

USD 345.00

In Stock

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2

CTBP2 Rabbit Polyclonal Antibody

TA323303

USD 345.00

In Stock

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CTBP2 Rabbit Polyclonal Antibody

TA351113

USD 345.00

In Stock

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human CTBP2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003S

USD 159.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTBP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

TA807909

USD 379.00

In Stock

CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CTBP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

TA807909S

USD 159.00

2 Days

CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 24 of 24 results