CTBP2 Rabbit Polyclonal Antibody

CAT#: TA339753

Rabbit Polyclonal Anti-CTBP2 Antibody

Product Images

WB Suggested Anti-CTBP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: A549 cell lysateCTBP2 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells

• 

  Sample Type: complete mouse retina sections; Red: Primary; Blue: DAPI; Primary Dilution: 1: 200; Secondary Antibody: Goat anti-Rabbit AF568 IgG (H+L); Secondary Dilution: 1: 200; Image Submitted by: David Zenisek; Yale University

• 

  Sample Type: outer mouse plexiform layer; Red: Primary; Blue: DAPI; Primary Dilution: 1: 200; Secondary Antibody: Goat anti-Rabbit AF568 IgG (H+L); Secondary Dilution: 1: 200; Image Submitted by: David Zenisek; Yale University

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: C-terminal binding protein 2
• Database Link:
  NP_001320
  Entrez Gene 13017 MouseEntrez Gene 1488 Human
  UniProt ID P56545
• Background: This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely.
• Synonyms: C-terminal binding protein 2; OTTHUMP00000020699; OTTHUMP00000020701; ribeye
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway
• Protein Pathways: Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway