Antibodies

View as table Download

Rabbit Polyclonal Anti-NLRC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV

Rabbit Polyclonal CARD12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human CARD12 protein (between residues 600-700) [UniProt Q9NPP4]

Rabbit Polyclonal CARD12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human CARD12 protein (between residues 950-1015) [UniProt Q9NPP4]