Antibodies

Jump to Filters
View as table Download
SCD1 (SCD) Rabbit Polyclonal Antibody
TA331172

USD 310.00

5 Days

Rabbit Polyclonal Anti-SCD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
SCD1 (SCD) Rabbit Polyclonal Antibody
TA351631

USD 345.00

In Stock

Rabbit Polyclonal Anti-SCD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCD