SCD1 (SCD) Rabbit Polyclonal Antibody

CAT#: TA331172

Rabbit Polyclonal Anti-SCD Antibody

Product Images

WB Suggested Anti-SCD Antibody Titration: 1.0ug/ml; Positive Control: Human Liver

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: stearoyl-CoA desaturase
• Database Link:
  NP_005054
  Entrez Gene 6319 Human
  UniProt ID O00767
• Background: Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.
• Synonyms: FADS5; hSCD1; MSTP008; SCD1; SCDOS
• Note: Human: 100%; Bovine: 92%; Dog: 85%; Pig: 85%; Goat: 85%; Sheep: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Biosynthesis of unsaturated fatty acids, PPAR signaling pathway