Antibodies

Jump to Filters
View as table Download
CDK1 Rabbit Polyclonal Antibody
TA326778

USD 275.00

3 Weeks

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1
CDK1 Rabbit Polyclonal Antibody
TA333178

USD 352.00

3 Weeks

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific
CDK1 Mouse Monoclonal Antibody [Clone ID: 26E11]
TA316617

USD 425.00

In Stock

CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CDK1 Rabbit Polyclonal Antibody
TA330359

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
CDK1 Rabbit Polyclonal Antibody
TA302013

USD 450.00

5 Days

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.
CDK1 Rabbit Polyclonal Antibody
TA321398

USD 345.00

In Stock

Anti-CDK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1