Antibodies

Jump to Filters
View as table Download
Claudin 8 (CLDN8) Rabbit Polyclonal Antibody
TA334199

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8. Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
Claudin 8 (CLDN8) Rabbit Polyclonal Antibody
TA350682

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLDN8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN8