Antibodies

Jump to Filters
View as table Download
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA330401

USD 310.00

5 Days

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: OTI2C4]
CF812677

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA350951

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV1
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA812677

USD 379.00

In Stock

CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA812677S

USD 159.00

In Stock

CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".