Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)
Applications | IHC, IP, WB |
Reactivities | Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep |
Conjugation | Unconjugated |
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)
Applications | IHC, IP, WB |
Reactivities | Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep |
Conjugation | Unconjugated |
Rabbit polyclonal HIF1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Hamster |
Conjugation | Unconjugated |
Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal HIF1A antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human HIF1A |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
Conjugation | Unconjugated |
Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit polyclonal HMGN phospho S20/S24 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-28 of human HMGN protein (see below). |
Mouse Monoclonal Anti-HIF1 alpha Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Cow |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-HIF1A antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS |
Rabbit Polyclonal Anti-HIF1A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIF1A |