Antibodies

Jump to Filters
View as table Download
ARIH2 Rabbit Polyclonal Antibody
TA335693

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARIH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARIH2 Antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL
ARIH2 Rabbit Polyclonal Antibody
TA366301

USD 380.00

4 Weeks

ARIH2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARIH2
ARIH2 Rabbit Polyclonal Antibody
TA370651

USD 380.00

4 Weeks

ARIH2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARIH2