ARIH2 Rabbit Polyclonal Antibody

CAT#: TA335693

Rabbit Polyclonal Anti-ARIH2 Antibody

Product Images

WB Suggested Anti-ARIH2 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ARIH2 is expressed in Jurkat

• 

  Host: Rabbit; Target Name: ARIH2; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1.25ug/mL; Peptide Concentration: 1.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%There is BioGPS gene expression data showing that ARIH2 is expressed in Jurkat

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARIH2 Antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: ariadne RBR E3 ubiquitin protein ligase 2
• Database Link:
  NP_006312
  Entrez Gene 10425 Human
  UniProt ID O95376
• Background: ARIH2 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates.
• Synonyms: ARI2; TRIAD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome