Antibodies

Jump to Filters
View as table Download
CLCC1 Rabbit Polyclonal Antibody
TA335946

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLCC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW
CLCC1 Rabbit Polyclonal Antibody
TA374837

USD 220.00

3 Weeks

CLCC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 302-501 of human CLCC1 (NP_055942.1).
Modifications Unmodified