CLCC1 Rabbit Polyclonal Antibody

CAT#: TA335946

Rabbit Polyclonal Anti-CLCC1 Antibody

Product Images

WB Suggested Anti-CLCC1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: chloride channel CLIC like 1
• Database Link:
  NP_001041675
  Entrez Gene 23155 Human
  UniProt ID Q96S66
• Background: CLCC1 seems to act as a chloride ion channel.
• Synonyms: MCLC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane