Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CLCC1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLCC1. |
Antibodies
View as table Download
CLCC1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-CLCC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW |
Rabbit Polyclonal Anti-CLCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: LDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGD |
CLCC1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 302-501 of human CLCC1 (NP_055942.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLCC1