Rabbit anti-DLD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DLD |
Rabbit anti-DLD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DLD |
Rabbit Polyclonal Anti-DLD Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DLD Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DLD |
DLD rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DLD |
DLDH/DLD Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 36-300 of human DLDH/DLDH/DLDH/DLD (NP_000099.2). |
Modifications | Unmodified |
USD 379.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".