Antibodies

Jump to Filters
View as table Download
EEF2 Rabbit Polyclonal Antibody
TA344333

USD 475.00

5 Days

Rabbit Polyclonal Anti-EEF2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEF2 antibody: synthetic peptide directed towards the N terminal of human EEF2. Synthetic peptide located within the following region: TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND
EEF2 Rabbit Polyclonal Antibody
TA349920

USD 345.00

In Stock

Rabbit Polyclonal Anti-EEF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EEF2
EEF2 Rabbit Polyclonal Antibody
TA364766

USD 380.00

4 Weeks

EEF2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EEF2
EEF2 Rabbit Polyclonal Antibody
TA384133

USD 380.00

4 Weeks

Elongation factor 2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human EEF2