Antibodies

View as table Download

KIF5A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIF5A

Rabbit Polyclonal KIF5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIF5 antibody was raised against a 20 amino acid synthetic peptide from near the carboxy terminus of human KIF5. The immunogen is located within amino acids 880 - 930 of KIF5.

Rabbit Polyclonal Anti-KIF5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF5A antibody: synthetic peptide directed towards the middle region of human KIF5A. Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH

KIF5A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIF5A