Mouse Monoclonal MBP Antibody (2H9)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TA336919 is a replacement of AM06698SU-N.
Mouse Monoclonal MBP Antibody (2H9)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MBP Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV |
Myelin Basic Protein / MBP Mouse Monoclonal (N-Terminus) (V/h5) Antibody
Applications | IHC |
Reactivities | Bovine, Guinea Pig, Human, Rabbit, Sheep |
Conjugation | Unconjugated |
MBP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MBP |
Rabbit Polyclonal Myelin Basic Protein Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 380.00
4 Weeks
Myelin Basic Protein (10D5) Mouse monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |