Antibodies

View as table Download

Mouse Monoclonal MBP Antibody (2H9)

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336919 is a replacement of AM06698SU-N.

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Myelin Basic Protein / MBP Mouse Monoclonal (N-Terminus) (V/h5) Antibody

Applications IHC
Reactivities Bovine, Guinea Pig, Human, Rabbit, Sheep
Conjugation Unconjugated

MBP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MBP

Rabbit Polyclonal Myelin Basic Protein Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated