Antibodies

View as table Download

Rabbit Polyclonal Anti-MSI2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Carrier-free (BSA/glycerol-free) MSI2 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MSI2

MSI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MSI2

MSI2 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSI2 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated