Antibodies

Jump to Filters
View as table Download
PCBP2 Rabbit Polyclonal Antibody
TA327374

USD 275.00

3 Weeks

PCBP2 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PCBP2
PCBP2 Rabbit Polyclonal Antibody
TA345905

USD 410.00

5 Days

Rabbit Polyclonal Anti-PCBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBP2 antibody: synthetic peptide directed towards the middle region of human PCBP2. Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
PCBP2 Rabbit Polyclonal Antibody
TA308051

USD 415.00

In Stock

Rabbit Polyclonal antibody to PCBP2 (poly(rC) binding protein 2)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 193 of PCBP2 (Uniprot ID#Q15366)