Antibodies

View as table Download

Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse and Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S).
Modifications Phospho-specific

Rabbit polyclonal PLCG1 (Tyr771) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-YP-G-A)
Modifications Phospho-specific

Rabbit polyclonal PTEN(Ab-380/382/383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383.

Rabbit polyclonal PLC-beta (Ser1105) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLC-β around the phosphorylation site of serine 1105 (N-N-SP-I-S).
Modifications Phospho-specific

Mouse Monoclonal PKC alpha Antibody (MC5)

Applications IHC
Reactivities Human, Mouse, Rat, Bovine, Canine, Fish, Porcine
Conjugation Unconjugated

Rabbit Polyclonal Anti-DGKH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW

Rabbit anti pTEN Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human PTEN protein. This sequence is identical among human, mouse, rat origins.

PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y).

PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y).

SHIP (INPP5D) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to C-terminal of human SHIP-1

Goat Polyclonal Antibody against PIK3CA

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQWLKDKNKGEIYD, from the internal region of the protein sequence according to NP_006209.2.

Goat Anti-PIK3C2A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TVKWYQLTAATYL, from the C Terminus of the protein sequence according to NP_002636.2.

Rabbit polyclonal anti-PIP5K antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIP5K.

INPP5J / PIB5PA Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Horse, Human, Pig
Immunogen INPP5J / PIB5PA antibody was raised against synthetic 19 amino acid peptide from internal region of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Elephant, Horse, Pig (100%); Gibbon, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Panda, Rabbit (95%); Bat, Platypus (89%).

INPP5J / PIB5PA Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Gorilla
Conjugation Unconjugated
Immunogen INPP5J / PIB5PA antibody was raised against synthetic 15 amino acid peptide from N-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (87%); Marmoset (80%).

Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2
Modifications Phospho-specific

Carrier-free (BSA/glycerol-free) PIP4K2A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DGKA mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DGKA mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI6D1

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI6C6 (formerly 6C6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody,clone OTI4G10

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody,clone OTI6H5

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody,clone OTI4B1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI6C5 (formerly 6C5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3R5 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2B mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2B mouse monoclonal antibody, clone OTI3B1 (formerly 3B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) PIK3CA mouse monoclonal antibody, clone OTI6D1 (formerly 6D1)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) PIK3CA mouse monoclonal antibody, clone OTI6D9 (formerly 6D9)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI15H1 (formerly 15H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIK3C2A mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated