SMAD6 mouse monoclonal antibody, clone 4C8
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 mouse monoclonal antibody, clone 4C8
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 (285-385) mouse monoclonal antibody, clone 4F3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 (285-385) mouse monoclonal antibody, clone 2A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SMAD6 mouse monoclonal antibody, clone 1G2
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-SMAD6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR |
SMAD6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |