Antibodies

Jump to Filters
View as table Download
ATOH1 Rabbit Polyclonal Antibody
TA330270

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATOH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATOH1 antibody: synthetic peptide directed towards the middle region of human ATOH1. Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS