ATOH1 Rabbit Polyclonal Antibody

CAT#: TA330270

Rabbit Polyclonal Anti-ATOH1 Antibody

Product Images

WB Suggested Anti-ATOH1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

• 

  Host: Rabbit; Target Name: ATOH1; Sample Tissue: Placenta; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane; Gel Concentration: 0.12%

• 

  mouse cochlea

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATOH1 antibody: synthetic peptide directed towards the middle region of human ATOH1. Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: atonal bHLH transcription factor 1
• Database Link:
  NP_005163
  Entrez Gene 11921 MouseEntrez Gene 474 Human
  UniProt ID Q92858
• Background: ATOH1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ATH1; bHLHa14; HATH1; MATH-1
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Mouse: 92%; Bovine: 92%; Dog: 85%; Horse: 85%; Rabbit: 83%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors