Antibodies

Jump to Filters
View as table Download
CHFR Rabbit Polyclonal Antibody
TA329877

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHFR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHFR antibody: synthetic peptide directed towards the N terminal of human CHFR. Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN
CHFR Goat Polyclonal Antibody
TA302851

USD 375.00

5 Days

Goat Polyclonal Antibody against CHFR

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KFNHICEQTRFKN, from the C Terminus of the protein sequence according to NP_060693.