Antibodies

Jump to Filters
View as table Download
CLIC1 Mouse Monoclonal Antibody [Clone ID: 3F9]
AM20871PU-N

USD 480.00

2 Weeks

CLIC1 mouse monoclonal antibody, clone 3F9

Applications ELISA, IHC, WB
Reactivities Human
CLIC1 Rabbit Polyclonal Antibody
AP14246PU-N

USD 450.00

2 Weeks

CLIC1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a recombinant human CLIC1 protein.
CLIC1 Rabbit Polyclonal Antibody
TA338517

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
CLIC1 Rabbit Polyclonal Antibody
TA350202

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1