Rabbit Polyclonal Anti-SLC22A7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A7 antibody: synthetic peptide directed towards the N terminal of human SLC22A7. Synthetic peptide located within the following region: LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS |
Rabbit Polyclonal anti-SLC22A7 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A7 antibody: synthetic peptide directed towards the C terminal of human SLC22A7. Synthetic peptide located within the following region: LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE |
Germany
Japan
United Kingdom
China
