SLC22A7 Rabbit Polyclonal Antibody

CAT#: TA329509

Rabbit Polyclonal anti-SLC22A7 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SLC22A7"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC22A7 antibody: synthetic peptide directed towards the C terminal of human SLC22A7. Synthetic peptide located within the following region: LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name solute carrier family 22 member 7
Background SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Synonyms NLT; OAT2
Note Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Dog: 91%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.