Antibodies

View as table Download

Rabbit Polyclonal Anti-STRAP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STRAP antibody: synthetic peptide directed towards the C terminal of human STRAP. Synthetic peptide located within the following region: ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL

Rabbit Polyclonal Anti-STRAP Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein