Antibodies

View as table Download

Rabbit Polyclonal LMX1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal LMX1A antibody was raised against a 16 amino acid peptide near the carboxy terminus of human LMX1A.

Rabbit Polyclonal Anti-LMX1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMX1A antibody: synthetic peptide directed towards the middle region of human LMX1A. Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL

Rabbit Polyclonal Anti-LMX1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMX1A antibody: synthetic peptide directed towards the middle region of human LMX1A. Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL