LMX1A Rabbit Polyclonal Antibody

CAT#: TA329739

Rabbit Polyclonal Anti-LMX1A Antibody

Product Images

WB Suggested Anti-LMX1A Antibody; Titration: 1 ug/ml; Positive Control: 721_B Whole Cell

• 

  Host: Rabbit; Target Name: TRIM10; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: LMX1A; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml

• 

  Rabbit Anti-LMX1A Antibody; Paraffin Embedded Tissue: Human Muscle; Cellular Data: Skeletal muscle cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LMX1A antibody: synthetic peptide directed towards the middle region of human LMX1A. Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: LIM homeobox transcription factor 1 alpha
• Database Link:
  NP_796372
  Entrez Gene 4009 Human
  UniProt ID Q8TE12
• Background: Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin. Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al., 1994 [PubMed 7698771]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-199 AL160058.8 14249-14447 c 200-2447 AK127724.1 362-2609 2448-3382 AL390730.12 9415-10349 c
• Synonyms: LMX1; LMX1.1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Horse: 86%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors