Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK9