Antibodies

View as table Download

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Canine, Human, Rabbit, Rat
Conjugation Unconjugated