Antibodies

Jump to Filters
View as table Download
ABO Rabbit Polyclonal Antibody
TA327092

USD 275.00

3 Weeks

ABO Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABO
ST3GAL4 Rabbit Polyclonal Antibody
TA339036

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST3GAL4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV
ABO Rabbit Polyclonal Antibody
TA351008

USD 345.00

In Stock

Rabbit Polyclonal Anti-ABO Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABO