Antibodies

Jump to Filters
View as table Download
Inhibin beta A (INHBA) Rabbit Polyclonal Antibody
TA308909

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A
WNT11 Rabbit Polyclonal Antibody
TA308507

USD 415.00

3 Weeks

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)
FAM3C Rabbit Polyclonal Antibody
TA316733

USD 425.00

In Stock

ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish
Conjugation Unconjugated
Immunogen ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C.
IGFBP5 Rabbit Polyclonal Antibody
TA316916

USD 425.00

2 Weeks

Anti-IGFBP-5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit
Conjugation Unconjugated
Immunogen IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%).
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
RA24603-100

USD 360.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish
Conjugation Unconjugated
WNT7A Rabbit Polyclonal Antibody
TA317522

USD 425.00

5 Days

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
WNT11 Rabbit Polyclonal Antibody
TA317956

USD 425.00

5 Days

WNT11 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%).
WNT1 Rabbit Polyclonal Antibody
TA341204

USD 425.00

5 Days

Rabbit Polyclonal Anti-WNT1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%).
WNT2 Rabbit Polyclonal Antibody
TA341208

USD 425.00

5 Days

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).
LOXL2 Rabbit Polyclonal Antibody
TA341294

USD 425.00

5 Days

Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%).