Antibodies

Jump to Filters
View as table Download
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308889

USD 415.00

In Stock

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA317706

USD 425.00

In Stock

GNAS Rabbit Polyclonal (aa385-394) Antibody

Applications IHC
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen GNAS antibody was raised against synthetic peptide from human GNAS.
G protein alpha S (GNAS) (164-394) Rabbit Polyclonal Antibody
AP23581PU-N

USD 440.00

2 Weeks

G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308888

USD 415.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329505

USD 310.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]
CF809270

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
CF809271

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323636

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323637

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7H4]
TA809260S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI7H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]
TA809270S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI7A6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D7]
TA809271AM

USD 420.00

4 Weeks

GNAS mouse monoclonal antibody,clone OTI13D7, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
G protein alpha S (GNAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13D7]
TA809271BM

USD 420.00

4 Weeks

GNAS mouse monoclonal antibody,clone OTI13D7, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
TA809271S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A4]
TA809314S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI7A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13G5]
TA809325S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI13G5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".