Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal PAK1 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
Rabbit polyclonal PAK1 (Phospho-Ser199) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1 (Phospho-Ser204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2 (Ab-199) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
| Modifications | Phospho-specific |
Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1. |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2/3 (Phospho-Thr423/402/421) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V). |
| Modifications | Phospho-specific |
Anti-PXN (Phospho-Tyr118) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 118 (H-V-Y(p)-S-F) derived from Human Paxillin. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |
Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β. |
| Modifications | Phospho-specific |
Anti-PXN Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human paxillin |
Anti-PAK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase |
Active filters
Reactivities
- Human
Applications
- IHC
Families
- Stem cell - Pluripotency
Pathways
- Chemokine signaling pathway