Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 47 of 47 results

(reset)

Hsc70 (HSPA8) Rabbit Polyclonal Antibody

TA346659

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Hsc70 (HSPA8) Rabbit Polyclonal Antibody

TA346660

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GADD45A Rabbit Polyclonal Antibody

TA332434

USD 275.00

3 Weeks

Rabbit anti-GADD45A Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GADD45A

1 / 2

2 / 2

Previous Next

Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: BB70]

TA309384

USD 430.00

2 Weeks

Mouse Monoclonal anti-Hsc70 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

Hsc70 (HSPA8) Rabbit Polyclonal Antibody

TA332519

USD 345.00

In Stock

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HSPA8

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA327567

USD 345.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TP53

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA323824

USD 345.00

In Stock

Anti-PAK1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase

1 / 2

2 / 2

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA326085

USD 345.00

In Stock

Rabbit polyclonal PAK1 (Ab-204) antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I).

1 / 3

2 / 3

3 / 3

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA326163

USD 345.00

In Stock

Rabbit polyclonal PAK1 (Phospho-Ser199) antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA326166

USD 345.00

4 Weeks

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA326177

USD 345.00

In Stock

Rabbit polyclonal PAK1 (Phospho-Ser204) antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA326197

USD 345.00

In Stock

Rabbit polyclonal PAK1/2 (Ab-199) antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y).

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA326222

USD 345.00

In Stock

Rabbit polyclonal MYC antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

1 / 2

2 / 2

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA323822

USD 345.00

4 Weeks

Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA325703

USD 345.00

4 Weeks

Rabbit Polyclonal C-myc antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human C-myc

1 / 2

2 / 2

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA326169

USD 345.00

In Stock

Rabbit polyclonal PAK1/2/3 (Phospho-Thr423/402/421) antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V).
Modifications	Phospho-specific

c-Myc (MYC) Rabbit Polyclonal Antibody

TA302042

USD 450.00

5 Days

Rabbit Polyclonal Antibody against MYC (T58)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA325949

USD 345.00

4 Weeks

Rabbit Polyclonal p53 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against a synthesized A synthesized peptide derived from human p53.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354205

USD 300.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the N-terminus of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354509

USD 325.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354572

USD 355.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: S20]

TA354364

USD 355.00

5 Days

Mouse anti p53 Monoclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF500002

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

CF500003

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

CF500004

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PPM1B Mouse Monoclonal Antibody [Clone ID: OTI3E8]

CF502900

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PPM1B mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

CF505966

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA323823

USD 345.00

In Stock

Anti-PAK1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase

GADD45A Rabbit Polyclonal Antibody

TA350003

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-GADD45A Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GADD45A

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

TA500003AM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F2]

TA500003BM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003S

USD 159.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G3]

TA500004AM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G3]

TA500004BM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PPM1B Mouse Monoclonal Antibody [Clone ID: OTI3E8]

TA502900

USD 379.00

In Stock

PPM1B mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E8]

TA502900AM

USD 420.00

4 Weeks

PPM1B mouse monoclonal antibody, clone OTI3E8 (formerly 3E8), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

PPM1B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E8]

TA502900BM

USD 420.00

4 Weeks

PPM1B mouse monoclonal antibody, clone OTI3E8 (formerly 3E8), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

PPM1B Mouse Monoclonal Antibody [Clone ID: OTI3E8]

TA502900S

USD 159.00

2 Days

PPM1B mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

TA505966

USD 379.00

In Stock

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hsc70 (HSPA8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

TA505966AM

USD 420.00

4 Weeks

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hsc70 (HSPA8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

TA505966BM

USD 420.00

4 Weeks

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hsc70 (HSPA8) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

TA505966S

USD 159.00

2 Days

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 47 of 47 results