Hsc70 (HSPA8) Rabbit Polyclonal Antibody

CAT#: TA346659

Rabbit Polyclonal Anti-HSPA8 Antibody

Product Images

HSPA8 antibody - N-terminal region validated by WB using Rat Brain lysate at 1: 1, 000.

• 

  WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

• 

  Host: Rabbit; Target Name: HIRIP3; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: NOP56; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml.HSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: RHOT1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Host: Rabbit; Target Name: HSPA8; Sample Tissue: Human 293T cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5.0 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 12%

• Sample Type: Mouse Brain Slices�; Red: primary; Blue: DAPI; Primary; Dilution: 1: 400�; Secondary Antibody: Anti-Rabbit IgG Alexa 594; Secondary; Dilution: 1: 400�; Image Submitted By: Adahir Labrador-Garrido and Cintia Roodveldt; University of Seville

• Rabbit Anti-HSPA8 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Nuclear in pinealocytes; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Show all 8 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: heat shock protein family A (Hsp70) member 8
• Database Link:
  NP_006588
  Entrez Gene 15481 MouseEntrez Gene 24468 RatEntrez Gene 3312 Human
  UniProt ID P11142
• Background: This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
• Synonyms: HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome