Rabbit Polyclonal Anti-PRDX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX3 antibody: synthetic peptide directed towards the N terminal of human PRDX3. Synthetic peptide located within the following region: AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS |
Anti-PRDX3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 63-256 amino acids of human peroxiredoxin 3 |
Anti-PRDX3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 242-256 amino acids of Human peroxiredoxin 3 |
Germany
Japan
United Kingdom
China
