Antibodies

View as table Download

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.

Rabbit polyclonal beta Catenin antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus.

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ

Mouse Monoclonal beta-Catenin Antibody (12F7)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Chicken, Primate
Conjugation Unconjugated

Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A).
Modifications Phospho-specific

Rabbit Polyclonal anti-TCF7L1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA

Rabbit Polyclonal Anti-TCF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM

Carrier-free (BSA/glycerol-free) Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9H2 (formerly 9H2)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9F6 (formerly 9F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTNNB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

CTNNB1 mouse monoclonal antibody, clone 1E10, Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

CTNNB1 mouse monoclonal antibody, clone 1E10, HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

CTNNB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTNNB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CTNNB1 mouse monoclonal antibody, clone 1B11, Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CTNNB1 mouse monoclonal antibody, clone 1B11, HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CTNNB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CTNNB1 mouse monoclonal antibody, clone OTI9H2 (formerly 9H2)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

CTNNB1 mouse monoclonal antibody, clone 9H2, Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

CTNNB1 mouse monoclonal antibody, clone 9H2, HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

CTNNB1 mouse monoclonal antibody, clone OTI9H2 (formerly 9H2)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".