Antibodies

Jump to Filters
View as table Download
SHARP2 (BHLHE40) Rabbit Polyclonal Antibody
TA334719

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-BHLHB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2. Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE
SHARP2 (BHLHE40) Mouse Monoclonal Antibody [Clone ID: OTI10H1]
CF810228

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) BHLHE40 mouse monoclonal antibody,clone OTI10H1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated