Goat Anti-AP-2 gamma Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NKTLEKMEKHRK, from the C Terminus of the protein sequence according to NP_003213.1. |
Goat Anti-AP-2 gamma Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NKTLEKMEKHRK, from the C Terminus of the protein sequence according to NP_003213.1. |
Rabbit Polyclonal Anti-TFAP2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TFAP2C Antibody: synthetic peptide directed towards the middle region of human TFAP2C. Synthetic peptide located within the following region: SPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVTL |
Rabbit Polyclonal Anti-TFAP2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TFAP2C antibody: synthetic peptide directed towards the N terminal of human TFAP2C. Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG |