Antibodies

Jump to Filters
View as table Download
EHF Rabbit Polyclonal Antibody
TA329428

USD 310.00

5 Days

Rabbit Polyclonal anti-EHF antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EHF antibody: synthetic peptide directed towards the N terminal of human EHF. Synthetic peptide located within the following region: RAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWK
EHF Rabbit Polyclonal Antibody
TA341756

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ehf Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ehf antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ