Antibodies

Jump to Filters
View as table Download
FOXM1 Rabbit Polyclonal Antibody
TA330367

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-FOXM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1. Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
FOXM1 Rabbit Polyclonal Antibody
TA329179

USD 375.00

5 Days

Rabbit Polyclonal anti-FOXM1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1. Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA