FOXM1 Rabbit Polyclonal Antibody

CAT#: TA330367

Rabbit Polyclonal Anti-FOXM1 Antibody

Product Images

Lanes: Lane 1: 25 ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25 ug MDA-MB-231 cell lysate; Lane 3: 25 ug Huh-7 cell lysate; Primary Antibody Dilution: 1:2000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1:5000; Gene Name

• 

  WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (AVARP03043_P050)

• 

  Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1. Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: forkhead box M1
• Database Link:
  NP_068772
  Entrez Gene 2305 Human
  UniProt ID Q08050
• Background: FOXM1 is a transcriptional activatory factor. It may play a role in the control of cell proliferation
• Synonyms: FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT
• Note: Immunogen sequence homology: Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 91%; Dog: 83%; Guinea pig: 83%; Pig: 83%

Reference Data

• Protein Families: Transcription Factors