Antibodies

Jump to Filters
View as table Download
SIRT4 Rabbit Polyclonal Antibody
TA330548

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SIRT4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the middle region of human SIRT4. Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV
SIRT4 Rabbit Polyclonal Antibody
TA351673

USD 345.00

In Stock

Rabbit Polyclonal Anti-SIRT4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIRT4